PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OGLUM01G39020.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family NAC
Protein Properties Length: 316aa    MW: 35060.7 Da    PI: 8.7319
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OGLUM01G39020.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM171.42.8e-53191461128
              NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevls 94 
                      lppGfrFhPtdeelvv+yL++kv++++l++  +i+evd+yk++PwdLp+k+  ++kewyfF++rd+ky++g+r+nra+ +gyWkatg dk+v  
  OGLUM01G39020.1  19 LPPGFRFHPTDEELVVHYLCRKVARQPLPV-PIIAEVDLYKLDPWDLPEKALFGRKEWYFFTPRDRKYPNGSRPNRAAGRGYWKATGADKPVAP 111
                      79****************************.88***************8877899**************************************9 PP

              NAM  95 k.kgelvglkktLvfykgrapkgektdWvmheyrl 128
                      k + ++vg+kk Lvfy+g+ap+g+ktdW+mheyrl
  OGLUM01G39020.1 112 KgSARTVGIKKALVFYSGKAPRGVKTDWIMHEYRL 146
                      866778***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019413.66E-6415173IPR003441NAC domain
PROSITE profilePS5100561.94319173IPR003441NAC domain
PfamPF023659.6E-2820146IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 316 aa     Download sequence    Send to blast
MAAAVGGSGR RDAEAELNLP PGFRFHPTDE ELVVHYLCRK VARQPLPVPI IAEVDLYKLD  60
PWDLPEKALF GRKEWYFFTP RDRKYPNGSR PNRAAGRGYW KATGADKPVA PKGSARTVGI  120
KKALVFYSGK APRGVKTDWI MHEYRLADAD RAPGGKKGSQ KLDEWVLCRL YNKKNNWEKV  180
KLEQQDVASV AAAAPRNHHH QNGEVMDAAA ADTMSDSFQT HDSDIDNASA GLRHGGCGGG  240
GFGDVAPPRN GFVTVKEDND WFTGLNFDEL QPPYMMNLQH MQMQMVNPAA AGHDGGYLQS  300
ISSPQMKMWQ TILPPF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A3e-9551791174Stress-induced transcription factor NAC1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB0281830.0AB028183.1 Oryza sativa mRNA for OsNAC4 protein, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015623706.10.0PREDICTED: NAC domain-containing protein 68
SwissprotQ52QH40.0NAC68_ORYSJ; NAC domain-containing protein 68
TrEMBLA0A0D9YGF90.0A0A0D9YGF9_9ORYZ; Uncharacterized protein
STRINGLOC_Os01g60020.10.0(Oryza sativa Japonica Group)
STRINGORGLA01G0288400.10.0(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP53893761
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G01720.11e-86NAC family protein